beta-NGF (Nerve growth factor-beta), Mouse
Nerve growth factor (NGF) is a neurotrophic factor and neuropeptide primarily involved in the regulation of growth, maintenance, proliferation, and survival of certain target neurons. NGF-β acts through its receptor β-NGFR and is involved in the development and maintenance of the sensory and sympathetic nervous systems. NGF-β also is also involved in the growth, differentiation, and survival of B lymphocytes. Human, mouse and rat proteins show cross-reactivity.
Sequence:
MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALT
TDEKQAAWRFIRIDTACVCVLSRKATRRG with polyhistidine tag at the C-terminus
UnitProt ID:
P01139
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse beta-NGF is > 1 x 106 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 4.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALT
TDEKQAAWRFIRIDTACVCVLSRKATRRG with polyhistidine tag at the C-terminus
UnitProt ID:
P01139
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse beta-NGF is > 1 x 106 IU/mg.
Purity:
>98% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 4.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
Reviews for beta-NGF (Nerve growth factor-beta), Mouse
Average Rating: 0 (0 Reviews )


